(data stored in ACNUC7421 zone)

EMBL: CP001389.PE334

CP001389.PE334       Location/Qualifiers
FT   CDS             388518..389633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03410"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24138"
FT                   /db_xref="GOA:C3MGM3"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM3"
FT                   /protein_id="ACP24138.1"
FT                   /translation="MVLAEPFPAQIGQGSFGRSAQGDYQRLSFTGSGKEYFGIWIVNIL
FT                   LTIVTLGIYSAWAKVRRNRYFYGNTVLLGRGFEYHARGGQILIGRLIVFAYLVVYNILL
FT                   TFVPLAGIALLLLLLCFVPWLVARGLRFSARVTSYRNVRFDFVGRAGGAFLAFIVGPVI
FT                   AALTLGILAPLASRWTYRYIGNNLRYGQKAFSTDPSIGTIYKSWAISAAIIILGLLIVG
FT                   FFAFLNFAVFVTAIESPDLIPAEMQVSIVVLVVLGYFLFFAIFGVAALVYRAGVRNVAW
FT                   SAATFDGKHRLLSDLSRLRYTWIAISNVVVTLVTLGLMRPWAAVRMARYVNEQTGVRFD
FT                   GNVGEIFSAIAQEGSAVGSEFMDIEGFDFGF"
     MVLAEPFPAQ IGQGSFGRSA QGDYQRLSFT GSGKEYFGIW IVNILLTIVT LGIYSAWAKV        60
     RRNRYFYGNT VLLGRGFEYH ARGGQILIGR LIVFAYLVVY NILLTFVPLA GIALLLLLLC       120
     FVPWLVARGL RFSARVTSYR NVRFDFVGRA GGAFLAFIVG PVIAALTLGI LAPLASRWTY       180
     RYIGNNLRYG QKAFSTDPSI GTIYKSWAIS AAIIILGLLI VGFFAFLNFA VFVTAIESPD       240
     LIPAEMQVSI VVLVVLGYFL FFAIFGVAAL VYRAGVRNVA WSAATFDGKH RLLSDLSRLR       300
     YTWIAISNVV VTLVTLGLMR PWAAVRMARY VNEQTGVRFD GNVGEIFSAI AQEGSAVGSE       360
     FMDIEGFDFG F                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page