(data stored in ACNUC7421 zone)

EMBL: CP001389.PE337

CP001389.PE337       Location/Qualifiers
FT   CDS             complement(391364..392407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03440"
FT                   /product="extracelluar solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24141"
FT                   /db_xref="GOA:C3MGM6"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM6"
FT                   /protein_id="ACP24141.1"
FT                   /translation="MLASKTLIGTLSVAAAILAFSAPARAEGEVNIYSYRQPDLIKPLL
FT                   DAFTKETGIAANVLFLDKGLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPLVNE
FT                   TINKDIPAHFRDPDGNWFGLTTRGRVVYASKERVPQNDITYEELADPKWKGKFCTRDGQ
FT                   HSYNIGLFASMIAHHGEAETEKWLTGFRDNLSKKPDGGDRDQAKAIFAGECDIALGNSY
FT                   YVGLMLTNDKEPQQKEWASAIKVLFPNAKDRGTHVNISGMALAKNAPNKENAVKLMEFL
FT                   SEGEAQKIYAEQVFEYPVLPGAEPSDVVKSFGTIKPDSLPLAEIAANRKKASELVDKVG
FT                   YNDGPQD"
     MLASKTLIGT LSVAAAILAF SAPARAEGEV NIYSYRQPDL IKPLLDAFTK ETGIAANVLF        60
     LDKGLVERIQ AEGANSPADV ILTVDISRLT EAKDAGVTQP LVNETINKDI PAHFRDPDGN       120
     WFGLTTRGRV VYASKERVPQ NDITYEELAD PKWKGKFCTR DGQHSYNIGL FASMIAHHGE       180
     AETEKWLTGF RDNLSKKPDG GDRDQAKAIF AGECDIALGN SYYVGLMLTN DKEPQQKEWA       240
     SAIKVLFPNA KDRGTHVNIS GMALAKNAPN KENAVKLMEF LSEGEAQKIY AEQVFEYPVL       300
     PGAEPSDVVK SFGTIKPDSL PLAEIAANRK KASELVDKVG YNDGPQD                     347
//

If you have problems or comments...

PBIL Back to PBIL home page