(data stored in ACNUC7421 zone)

EMBL: CP001389.PE34

CP001389.PE34        Location/Qualifiers
FT   CDS             37702..38094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00340"
FT                   /product="predicted glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23838"
FT                   /db_xref="GOA:C3MF01"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF01"
FT                   /protein_id="ACP23838.1"
FT                   /translation="MKQTIARIAILVPDYDEGLAFYCGRLGFELIEDTDLGAGKRWVLV
FT                   RPTGATETALLIAKAEGERQNAAIGNQAGGRVGFFLFTDDFARDHAAMLAAGVEFLEPP
FT                   RHEAYGTVAVFTDPFGNRWDLLQPAS"
     MKQTIARIAI LVPDYDEGLA FYCGRLGFEL IEDTDLGAGK RWVLVRPTGA TETALLIAKA        60
     EGERQNAAIG NQAGGRVGFF LFTDDFARDH AAMLAAGVEF LEPPRHEAYG TVAVFTDPFG       120
     NRWDLLQPAS                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page