(data stored in ACNUC7421 zone)

EMBL: CP001389.PE344

CP001389.PE344       Location/Qualifiers
FT   CDS             398851..399195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03510"
FT                   /product="putative endoribonuclease L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24148"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN3"
FT                   /protein_id="ACP24148.1"
FT                   /translation="MEIKRFETGPRMSQAVVYNNTVYLAGQVGNAGDDVVTQTKQALAE
FT                   VDRLLALAGTDKTRILSATVWLADMADFAKMNSVWDAWAPQGHTPARATGEAKLATPEY
FT                   LVEVIVTAAV"
     MEIKRFETGP RMSQAVVYNN TVYLAGQVGN AGDDVVTQTK QALAEVDRLL ALAGTDKTRI        60
     LSATVWLADM ADFAKMNSVW DAWAPQGHTP ARATGEAKLA TPEYLVEVIV TAAV             114
//

If you have problems or comments...

PBIL Back to PBIL home page