(data stored in ACNUC7421 zone)

EMBL: CP001389.PE346

CP001389.PE346       Location/Qualifiers
FT   CDS             399663..400787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03530"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24150"
FT                   /db_xref="GOA:C3MGN5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN5"
FT                   /protein_id="ACP24150.1"
FT                   /translation="MDSKVVAAVRSRKRSAEKELALAQATTAARKRDGMDLVVAWSVVG
FT                   LFVVACSAVVYAMAAILMPIAFAIVVGIVLGRAADELARFGLPPMLGGLLLALFFVLGL
FT                   SSLVNTLLGPITELAREAPKLAESVVERVLPFIERFEWGRIALARSVGADAFADVVVKN
FT                   AGPILGAAAASVTPALIQTLIFLAALVLFLLGRVQLRSTIILAFPSRDGRLSAIRIMNA
FT                   IEDGLTRYFSTASLIYLALGGFTMMIALVGGLPMPPLWGLFAFVSSFIPYLGVTFMTLS
FT                   LLVGGLMTHEALVVALAPATAFFLIHLAMENLVVPAILGRRFEVNPFLIFVAILFWTWM
FT                   WGAVGAILAMPLSLIAMTIFEQLREPPPEPQLPG"
     MDSKVVAAVR SRKRSAEKEL ALAQATTAAR KRDGMDLVVA WSVVGLFVVA CSAVVYAMAA        60
     ILMPIAFAIV VGIVLGRAAD ELARFGLPPM LGGLLLALFF VLGLSSLVNT LLGPITELAR       120
     EAPKLAESVV ERVLPFIERF EWGRIALARS VGADAFADVV VKNAGPILGA AAASVTPALI       180
     QTLIFLAALV LFLLGRVQLR STIILAFPSR DGRLSAIRIM NAIEDGLTRY FSTASLIYLA       240
     LGGFTMMIAL VGGLPMPPLW GLFAFVSSFI PYLGVTFMTL SLLVGGLMTH EALVVALAPA       300
     TAFFLIHLAM ENLVVPAILG RRFEVNPFLI FVAILFWTWM WGAVGAILAM PLSLIAMTIF       360
     EQLREPPPEP QLPG                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page