(data stored in ACNUC7421 zone)

EMBL: CP001389.PE347

CP001389.PE347       Location/Qualifiers
FT   CDS             complement(400792..401589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03540"
FT                   /product="predicted two-component signal transduction
FT                   response regulator, contains receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24151"
FT                   /db_xref="GOA:C3MGN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN6"
FT                   /protein_id="ACP24151.1"
FT                   /translation="MSLSTRIAPHLPYLRRYARAVTGSQAAGDAYVAAVLEALIEDISL
FT                   FPSASNDRISLYKLFCSLFDKLKVDRSHLSSPFAWEKRAAANLSLIAPTPRQAFLLISV
FT                   EGFSSGEAAEIMSIDQGAFAKLLSSASEEISRQVATDIMIIEDEPLIAMDIEDMVTSLG
FT                   HRVTGIARTHREAIDIYRQTSPKMVLADIQLADGSSGIDAVNDILTQAAVPVIFITAFP
FT                   ERLLTGNKPEPAFLVTKPFNPEMVKALISQALFFDEQAHAASR"
     MSLSTRIAPH LPYLRRYARA VTGSQAAGDA YVAAVLEALI EDISLFPSAS NDRISLYKLF        60
     CSLFDKLKVD RSHLSSPFAW EKRAAANLSL IAPTPRQAFL LISVEGFSSG EAAEIMSIDQ       120
     GAFAKLLSSA SEEISRQVAT DIMIIEDEPL IAMDIEDMVT SLGHRVTGIA RTHREAIDIY       180
     RQTSPKMVLA DIQLADGSSG IDAVNDILTQ AAVPVIFITA FPERLLTGNK PEPAFLVTKP       240
     FNPEMVKALI SQALFFDEQA HAASR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page