(data stored in ACNUC7421 zone)

EMBL: CP001389.PE348

CP001389.PE348       Location/Qualifiers
FT   CDS             401762..401953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24152"
FT                   /db_xref="InterPro:IPR041649"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN7"
FT                   /protein_id="ACP24152.1"
FT                   /translation="MNDRSDGRARGISAAGARKNDANGVIASRLRALYQAIESEPVPQQ
FT                   FIDLLRRLDEAERAQSGD"
     MNDRSDGRAR GISAAGARKN DANGVIASRL RALYQAIESE PVPQQFIDLL RRLDEAERAQ        60
     SGD                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page