(data stored in ACNUC7421 zone)

EMBL: CP001389.PE349

CP001389.PE349       Location/Qualifiers
FT   CDS             complement(402058..402306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24153"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN8"
FT                   /protein_id="ACP24153.1"
FT                   /translation="MKKILLVVSVILPLAACTQTEKGAAIGAASGGIIGGAISNDVRGA
FT                   AVGAAVGGVAGALIGRASEPGYCVYRDRYGRRYTARC"
     MKKILLVVSV ILPLAACTQT EKGAAIGAAS GGIIGGAISN DVRGAAVGAA VGGVAGALIG        60
     RASEPGYCVY RDRYGRRYTA RC                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page