(data stored in ACNUC7421 zone)

EMBL: CP001389.PE353

CP001389.PE353       Location/Qualifiers
FT   CDS             404979..405224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP2"
FT                   /protein_id="ACP24157.1"
FT                   /translation="MNRQTIEFAGEAVGALMPDNGQLRFVAVKYSVWSLDGRIFSTAEE
FT                   ALRAVAALHVLRQRGPVGAAPVPTGPDEAFISAGSA"
     MNRQTIEFAG EAVGALMPDN GQLRFVAVKY SVWSLDGRIF STAEEALRAV AALHVLRQRG        60
     PVGAAPVPTG PDEAFISAGS A                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page