(data stored in ACNUC7421 zone)

EMBL: CP001389.PE354

CP001389.PE354       Location/Qualifiers
FT   CDS             complement(405399..405962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03610"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24158"
FT                   /db_xref="GOA:C3MGP3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP3"
FT                   /protein_id="ACP24158.1"
FT                   /translation="MDQILADILVSTRTPYPVIFARLCGAIVLGALIGIEREKRQRPAG
FT                   LRTHILVSLASAIFAVVAVESVHMTSLSGPEVRIDPIRVVEAVTAGVAFLAAGMIVFSK
FT                   GEVKGLTTGAGMWLAGAVGISVGFGFWMIATFAAVASLIVLFILGRMEVALQWKEPEGE
FT                   GNGARETGRHPAPGAPAGSDDGSR"
     MDQILADILV STRTPYPVIF ARLCGAIVLG ALIGIEREKR QRPAGLRTHI LVSLASAIFA        60
     VVAVESVHMT SLSGPEVRID PIRVVEAVTA GVAFLAAGMI VFSKGEVKGL TTGAGMWLAG       120
     AVGISVGFGF WMIATFAAVA SLIVLFILGR MEVALQWKEP EGEGNGARET GRHPAPGAPA       180
     GSDDGSR                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page