(data stored in ACNUC7421 zone)

EMBL: CP001389.PE355

CP001389.PE355       Location/Qualifiers
FT   CDS             complement(406056..406442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24159"
FT                   /db_xref="GOA:C3MGP4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP4"
FT                   /protein_id="ACP24159.1"
FT                   /translation="MDPQDQLKERPPVDPVTGQPAPPPEVHEARASRSSWPLLVILLAG
FT                   LVLALIAWLPAELTRDAEDTPTSSTTTTQPATDEPATGTEATPPAGGTTQEPAPAAPET
FT                   QPQPTPPAPAPEGTAPQPQTPPAQ"
     MDPQDQLKER PPVDPVTGQP APPPEVHEAR ASRSSWPLLV ILLAGLVLAL IAWLPAELTR        60
     DAEDTPTSST TTTQPATDEP ATGTEATPPA GGTTQEPAPA APETQPQPTP PAPAPEGTAP       120
     QPQTPPAQ                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page