(data stored in ACNUC7421 zone)

EMBL: CP001389.PE356

CP001389.PE356       Location/Qualifiers
FT   CDS             406728..407873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24160"
FT                   /db_xref="GOA:C3MGP5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP5"
FT                   /protein_id="ACP24160.1"
FT                   /translation="MKMTTAYETGTFVGRAWRPDVEGPSLVTVRDGELIDITSKRVPTM
FT                   RDLLDLSDPVAHARSASGEAIASVDAVMARPAGGSDEVHLLAPCDLQAVKACGVTFARS
FT                   MIERVIEERAAGDATRAETIRARMTAIIGDSLRNLKAGSPEAAGVKAALIDEGVWSQYL
FT                   EVGIGPDAEVFTKAQPLSSVGWGAAVGLHPISRWNNPEPEIVLAVSADGRIKGATLGND
FT                   VNLRDVEGRSALLLGKAKDNNASCAIGPFIRLFDETYSIDDVRHADLDLLIEGPDGFHL
FT                   KGASTMREISRDPLDLVAQTIGSHHQYPDGLMLFMGTLFAPVEDRGEPGQGFTHKIGDV
FT                   VTISSPALGSLVNTVRLSTDCPPWTFGTAALMRNLAKRGLL"
     MKMTTAYETG TFVGRAWRPD VEGPSLVTVR DGELIDITSK RVPTMRDLLD LSDPVAHARS        60
     ASGEAIASVD AVMARPAGGS DEVHLLAPCD LQAVKACGVT FARSMIERVI EERAAGDATR       120
     AETIRARMTA IIGDSLRNLK AGSPEAAGVK AALIDEGVWS QYLEVGIGPD AEVFTKAQPL       180
     SSVGWGAAVG LHPISRWNNP EPEIVLAVSA DGRIKGATLG NDVNLRDVEG RSALLLGKAK       240
     DNNASCAIGP FIRLFDETYS IDDVRHADLD LLIEGPDGFH LKGASTMREI SRDPLDLVAQ       300
     TIGSHHQYPD GLMLFMGTLF APVEDRGEPG QGFTHKIGDV VTISSPALGS LVNTVRLSTD       360
     CPPWTFGTAA LMRNLAKRGL L                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page