(data stored in ACNUC7421 zone)

EMBL: CP001389.PE357

CP001389.PE357       Location/Qualifiers
FT   CDS             407934..408326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24161"
FT                   /db_xref="InterPro:IPR014587"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP6"
FT                   /protein_id="ACP24161.1"
FT                   /translation="MDRRGLGVEMKVAIGLAAASLFVAVAAHPLRAEPLRSVDEVSEAL
FT                   GKCWTPPAGIKGSFVTLKFGFRGNGTLMGPPQPTAIRVTGDADQREAFVAAATEALEKC
FT                   MPLEFTQELAGEIAGNVFTLQFFSAD"
     MDRRGLGVEM KVAIGLAAAS LFVAVAAHPL RAEPLRSVDE VSEALGKCWT PPAGIKGSFV        60
     TLKFGFRGNG TLMGPPQPTA IRVTGDADQR EAFVAAATEA LEKCMPLEFT QELAGEIAGN       120
     VFTLQFFSAD                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page