(data stored in ACNUC7421 zone)

EMBL: CP001389.PE358

CP001389.PE358       Location/Qualifiers
FT   CDS             408527..411484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03650"
FT                   /product="hemolysin-type calcium-binding repeat-like
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24162"
FT                   /db_xref="GOA:C3MGP7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP7"
FT                   /protein_id="ACP24162.1"
FT                   /translation="MSKKVKSIAPPQASLALDPLAAAYTIPGVGDQTVNGDDASNSIST
FT                   GSGLDTINGGLGADTIRAGTGDDEILNMNVEALVGDQIDGGLGFDELGIDFSGSSKGVS
FT                   FTAFDPIVSKAVLGATIVNVERFELEGSNFADSFTGGRWDDWFEGGAGDDVLNGGIGKD
FT                   WLSGDGGSDRIYGGNGGDSVLGGAGDDYLSGGYGVDWLSADEGNDTLLGGAGGDYLYGH
FT                   SGNDNIKGESGTDTISGGSGRDTIDGGSEDDYLAGDGDNDTVLGGAGNDTIRHNMESWA
FT                   NDGKDVLDGGIGHDEVVLVGLSGTFTAKSSATKQTLSNGTTIVNFEAYTINGSETADRF
FT                   TGWTGADTLSGYSGNDTLIGLAGNDHLDGGLGSDILDGGDGNDLLIVGSGGKDVIKGGT
FT                   GYDTIWIDRSDGTTGLTFTVSGTTAKLSDGTVVTDGESFRIETGSGSDIISAGTAGYLS
FT                   IDAGSGNNRLTGGKGGDSFYSTSGSDTVSGGDGDDRIADYGGGTNKLDGGNGNDSVSAE
FT                   TETGTALTTMLGGAGSDSLSVNYGGGSTAGRFSVDGGSGTDTLWISRYDSTKNLTFVLS
FT                   ANATLVNGDVTVKNIEKINFTSGQGHDTLTAGSLDDDLNGMGGNDTLKGLGGDDDLTGW
FT                   TGADTLYGGDGNDGLWGSGGIKDTSADRLHGEKGNDVLNVNAGDYASGGDGFDRLVIEF
FT                   GEETFDVSFVFGNGLVKVNANTSFTGMEALEYVGGSGKDAVTGSAQIDYLDGGLGNDTL
FT                   RGGGGNDYLIDGRGNDRLYGDAGNDTFDRFSDGTGTDHFDGGSGVDTLEFDIISDQSVI
FT                   VDLENSARNGGVATGLTLVSIENVVGQNTDDTILGNGVANTLKGGMGDDRLDGRAGNDK
FT                   LEGGAHGDLLTGGTGADQFIYASGDAIGSGDQITDFKRGEDKLVIDKGVFHFSNLVLYS
FT                   GTDLKATGTAAQFFFEKDNGRLWYDADGTGNEADAVLVATLDKVTSLATTDFLLT"
     MSKKVKSIAP PQASLALDPL AAAYTIPGVG DQTVNGDDAS NSISTGSGLD TINGGLGADT        60
     IRAGTGDDEI LNMNVEALVG DQIDGGLGFD ELGIDFSGSS KGVSFTAFDP IVSKAVLGAT       120
     IVNVERFELE GSNFADSFTG GRWDDWFEGG AGDDVLNGGI GKDWLSGDGG SDRIYGGNGG       180
     DSVLGGAGDD YLSGGYGVDW LSADEGNDTL LGGAGGDYLY GHSGNDNIKG ESGTDTISGG       240
     SGRDTIDGGS EDDYLAGDGD NDTVLGGAGN DTIRHNMESW ANDGKDVLDG GIGHDEVVLV       300
     GLSGTFTAKS SATKQTLSNG TTIVNFEAYT INGSETADRF TGWTGADTLS GYSGNDTLIG       360
     LAGNDHLDGG LGSDILDGGD GNDLLIVGSG GKDVIKGGTG YDTIWIDRSD GTTGLTFTVS       420
     GTTAKLSDGT VVTDGESFRI ETGSGSDIIS AGTAGYLSID AGSGNNRLTG GKGGDSFYST       480
     SGSDTVSGGD GDDRIADYGG GTNKLDGGNG NDSVSAETET GTALTTMLGG AGSDSLSVNY       540
     GGGSTAGRFS VDGGSGTDTL WISRYDSTKN LTFVLSANAT LVNGDVTVKN IEKINFTSGQ       600
     GHDTLTAGSL DDDLNGMGGN DTLKGLGGDD DLTGWTGADT LYGGDGNDGL WGSGGIKDTS       660
     ADRLHGEKGN DVLNVNAGDY ASGGDGFDRL VIEFGEETFD VSFVFGNGLV KVNANTSFTG       720
     MEALEYVGGS GKDAVTGSAQ IDYLDGGLGN DTLRGGGGND YLIDGRGNDR LYGDAGNDTF       780
     DRFSDGTGTD HFDGGSGVDT LEFDIISDQS VIVDLENSAR NGGVATGLTL VSIENVVGQN       840
     TDDTILGNGV ANTLKGGMGD DRLDGRAGND KLEGGAHGDL LTGGTGADQF IYASGDAIGS       900
     GDQITDFKRG EDKLVIDKGV FHFSNLVLYS GTDLKATGTA AQFFFEKDNG RLWYDADGTG       960
     NEADAVLVAT LDKVTSLATT DFLLT                                             985
//

If you have problems or comments...

PBIL Back to PBIL home page