(data stored in ACNUC7421 zone)

EMBL: CP001389.PE359

CP001389.PE359       Location/Qualifiers
FT   CDS             complement(411567..411875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24163"
FT                   /db_xref="GOA:C3MGP8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP8"
FT                   /protein_id="ACP24163.1"
FT                   /translation="MLRHADNSKGTPAAGSVSDAAPAGITATDVAADWLSLAAAPTFAI
FT                   MALLAGVLGGPADMLCSSAGDAPAITGMVPMYVLMSAFHSAPWLRLISGQRRPACRS"
     MLRHADNSKG TPAAGSVSDA APAGITATDV AADWLSLAAA PTFAIMALLA GVLGGPADML        60
     CSSAGDAPAI TGMVPMYVLM SAFHSAPWLR LISGQRRPAC RS                          102
//

If you have problems or comments...

PBIL Back to PBIL home page