(data stored in ACNUC7421 zone)

EMBL: CP001389.PE36

CP001389.PE36        Location/Qualifiers
FT   CDS             39262..39777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00360"
FT                   /product="predicted universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23840"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF03"
FT                   /protein_id="ACP23840.1"
FT                   /translation="MRRCNVRRMVSTRLSRLEGHRRKFMAVIDDTPECGRAVHYAGMRA
FT                   KNSNGGLVLLYVIADGDFQQWLGVEEIMRAEAREEAEATLAKVAQTVRERIGIEPEIVI
FT                   REGIATDQIYALIEEDRDIAILVLAAGSAKEGPGPLVSSIAGKAAAFPIPVTVIPDLLT
FT                   DEEIDALS"
     MRRCNVRRMV STRLSRLEGH RRKFMAVIDD TPECGRAVHY AGMRAKNSNG GLVLLYVIAD        60
     GDFQQWLGVE EIMRAEAREE AEATLAKVAQ TVRERIGIEP EIVIREGIAT DQIYALIEED       120
     RDIAILVLAA GSAKEGPGPL VSSIAGKAAA FPIPVTVIPD LLTDEEIDAL S                171
//

If you have problems or comments...

PBIL Back to PBIL home page