(data stored in ACNUC7421 zone)

EMBL: CP001389.PE361

CP001389.PE361       Location/Qualifiers
FT   CDS             412774..413991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24165"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ0"
FT                   /protein_id="ACP24165.1"
FT                   /translation="MDSLITAAARALATGDPLGALKRVALRDDPPALALRGIAMAQLGD
FT                   FARAKVLLKNATRAFGPKEAVARARCVVAEAEIALVSRDLSFPAKALDAALATLEKHRD
FT                   WVNAAHARNLEVRRLLLVGRLDGAERALADIDPAPLPPASRAAYELAVAGIAIRRLRTK
FT                   AARAALARAGQAAREANIPALAAEVESASLVLETPAARLIAQGEARPLLLEEVEALLAS
FT                   QALVVDACRHVLRGEGTVVSLETRPVLFALARALAEAWPGDVPRGTLVARAFRAKHADE
FT                   SHRARLRVEIGRLRAELATLAEVRATKRGFALAPRAGEVVVLAPPVEGQHAAVLALLAD
FT                   GEAWSSSALAIALGASPRTVQRALEALAASDQVRSFGLGRARRWMTPPVPAFPTILLLP
FT                   GPLPGD"
     MDSLITAAAR ALATGDPLGA LKRVALRDDP PALALRGIAM AQLGDFARAK VLLKNATRAF        60
     GPKEAVARAR CVVAEAEIAL VSRDLSFPAK ALDAALATLE KHRDWVNAAH ARNLEVRRLL       120
     LVGRLDGAER ALADIDPAPL PPASRAAYEL AVAGIAIRRL RTKAARAALA RAGQAAREAN       180
     IPALAAEVES ASLVLETPAA RLIAQGEARP LLLEEVEALL ASQALVVDAC RHVLRGEGTV       240
     VSLETRPVLF ALARALAEAW PGDVPRGTLV ARAFRAKHAD ESHRARLRVE IGRLRAELAT       300
     LAEVRATKRG FALAPRAGEV VVLAPPVEGQ HAAVLALLAD GEAWSSSALA IALGASPRTV       360
     QRALEALAAS DQVRSFGLGR ARRWMTPPVP AFPTILLLPG PLPGD                       405
//

If you have problems or comments...

PBIL Back to PBIL home page