(data stored in ACNUC7421 zone)

EMBL: CP001389.PE362

CP001389.PE362       Location/Qualifiers
FT   CDS             414034..414666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24166"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ1"
FT                   /protein_id="ACP24166.1"
FT                   /translation="MKYSQAEILREYGPFPGADNVHGVTFDGEHVWFASGDKLNAFDPA
FT                   TGETVRAIDVAAHAGTAFDGRHLYQIAEDRIQKIDPKTGRVLSTIPAPGAGGDSGLTWA
FT                   EGTLWVGQHRGRKIHQIDPETGAILRTIESNRVVTGVTWIDGELWHGTWEDDASEVRRV
FT                   DPATGKVLETLEMPEGIGVSGLESDGGDRLFCGGGKSGKVRVVKKPR"
     MKYSQAEILR EYGPFPGADN VHGVTFDGEH VWFASGDKLN AFDPATGETV RAIDVAAHAG        60
     TAFDGRHLYQ IAEDRIQKID PKTGRVLSTI PAPGAGGDSG LTWAEGTLWV GQHRGRKIHQ       120
     IDPETGAILR TIESNRVVTG VTWIDGELWH GTWEDDASEV RRVDPATGKV LETLEMPEGI       180
     GVSGLESDGG DRLFCGGGKS GKVRVVKKPR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page