(data stored in ACNUC7421 zone)

EMBL: CP001389.PE366

CP001389.PE366       Location/Qualifiers
FT   CDS             418050..418433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24170"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ5"
FT                   /protein_id="ACP24170.1"
FT                   /translation="MLLYVTVGTNDLERAGAFYDAVLPTLGYRRQRQDETEIGYGADGD
FT                   VRVRFWVVTPFNREPATYGNGVSIALAAETRGAVDAFHAAALAAGGADEGAPGLRPFHA
FT                   HFYGAWVRDLDGNKIAAVCERPE"
     MLLYVTVGTN DLERAGAFYD AVLPTLGYRR QRQDETEIGY GADGDVRVRF WVVTPFNREP        60
     ATYGNGVSIA LAAETRGAVD AFHAAALAAG GADEGAPGLR PFHAHFYGAW VRDLDGNKIA       120
     AVCERPE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page