(data stored in ACNUC7421 zone)

EMBL: CP001389.PE368

CP001389.PE368       Location/Qualifiers
FT   CDS             420401..421549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03760"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24172"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ7"
FT                   /protein_id="ACP24172.1"
FT                   /translation="MRGRRPVDGSGGFVGAKPAIADQKPVIRLTFSVKAATSCLPAHDS
FT                   RGSANQQERSMITQNLKRRTLFGAGAAALAAPGLLTGIANAQESAEKDAMTKDAALKTF
FT                   RLGTFKVTVISDGTRASDNPHETYGTNQPAEAVTALLEQNFLPGSGFINGFSPVLVDTG
FT                   SEIVLFDTGLGEGGRAAGTGKLADGIRAAGYTPEQVSVIVITHMHGDHIGGLTEGGKPA
FT                   FANARYVTGQVEFDFWKDAARVGTPAENGHKAVLAKVAPLAEKTTFIADGVEVVPGIAA
FT                   IAAFGHSPGHMIYRLESEGKALILTADTANHYVLSLQRPDWEVRFDMDKAAASATRRKV
FT                   FDMIATDRLPFIGYHMPFPAVGFVERQDQGYRFVPATYQFDI"
     MRGRRPVDGS GGFVGAKPAI ADQKPVIRLT FSVKAATSCL PAHDSRGSAN QQERSMITQN        60
     LKRRTLFGAG AAALAAPGLL TGIANAQESA EKDAMTKDAA LKTFRLGTFK VTVISDGTRA       120
     SDNPHETYGT NQPAEAVTAL LEQNFLPGSG FINGFSPVLV DTGSEIVLFD TGLGEGGRAA       180
     GTGKLADGIR AAGYTPEQVS VIVITHMHGD HIGGLTEGGK PAFANARYVT GQVEFDFWKD       240
     AARVGTPAEN GHKAVLAKVA PLAEKTTFIA DGVEVVPGIA AIAAFGHSPG HMIYRLESEG       300
     KALILTADTA NHYVLSLQRP DWEVRFDMDK AAASATRRKV FDMIATDRLP FIGYHMPFPA       360
     VGFVERQDQG YRFVPATYQF DI                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page