(data stored in ACNUC7421 zone)

EMBL: CP001389.PE37

CP001389.PE37        Location/Qualifiers
FT   CDS             39885..40451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00370"
FT                   /product="putative scaffold protein Nfu/NifU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23841"
FT                   /db_xref="GOA:C3MF04"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF04"
FT                   /protein_id="ACP23841.1"
FT                   /translation="MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEARTGSPLAAR
FT                   LFSIPGVSGVYFGYDFITVSKEGQEWQHLKPAVLGSIMEHFMSGQPIMSGASRAEETDQ
FT                   EGEFYDEGDEAIVATIKELLDTRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSS
FT                   TATLRHGVQNLLRHFVPEVESVESV"
     MFIQTEATPN PATLKFLPGK VVMENGTAEF RSEEEARTGS PLAARLFSIP GVSGVYFGYD        60
     FITVSKEGQE WQHLKPAVLG SIMEHFMSGQ PIMSGASRAE ETDQEGEFYD EGDEAIVATI       120
     KELLDTRVRP AVAQDGGDIT FRGFKDGTVF LNMKGACSGC PSSTATLRHG VQNLLRHFVP       180
     EVESVESV                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page