(data stored in ACNUC7421 zone)

EMBL: CP001389.PE370

CP001389.PE370       Location/Qualifiers
FT   CDS             423324..423740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24174"
FT                   /db_xref="GOA:C3MGQ9"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ9"
FT                   /protein_id="ACP24174.1"
FT                   /translation="MSGFEIFWPVVAHVGLVFMLYALLSLRRSAVVRAGKAEASQFREN
FT                   RGEPSESLVVRNSIANQFELPTLFHVCCVLCFVTEADSLLAVGLAWIFVGFRYAHAFVH
FT                   VTSNRLRYRGPLFLAGFVTLGAMWAWLALWMAMN"
     MSGFEIFWPV VAHVGLVFML YALLSLRRSA VVRAGKAEAS QFRENRGEPS ESLVVRNSIA        60
     NQFELPTLFH VCCVLCFVTE ADSLLAVGLA WIFVGFRYAH AFVHVTSNRL RYRGPLFLAG       120
     FVTLGAMWAW LALWMAMN                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page