(data stored in ACNUC7421 zone)

EMBL: CP001389.PE371

CP001389.PE371       Location/Qualifiers
FT   CDS             423828..424910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03790"
FT                   /product="alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24175"
FT                   /db_xref="GOA:C3MGR0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR0"
FT                   /protein_id="ACP24175.1"
FT                   /translation="MWRAPPLDFLRRPSEEEIDMTGTMKAAVVREFGKPLVIEELPIPQ
FT                   PGPGQVLIKYEATGVCHTDLHAAKGDWPVRPNPPFIPGHEGVGYVAKLGAGVTRLKEGD
FT                   RVGVPWLHTACGCCTPCRTGWETLCGSQQNTGYSVDGTFAQYGLADPDFVGTLPAKLEF
FT                   GPAAPVLCAGVTVYKGLKETEVRPGEWVLVSGIGGLGHMAVQYAKAMGMHVAAADIFPD
FT                   KLALAEKLGADLVVDAKAADAIEEVQKRTGGVHGALVTAVSPKAMEQAYRMLRSKGTMA
FT                   LVGLPPSQICLPVFDTVLKRITVRGSIVGTRQDLEEALEFAGEGKVGAHFSWDKIENIN
FT                   AIFERMEEGKIDGRIVLDLN"
     MWRAPPLDFL RRPSEEEIDM TGTMKAAVVR EFGKPLVIEE LPIPQPGPGQ VLIKYEATGV        60
     CHTDLHAAKG DWPVRPNPPF IPGHEGVGYV AKLGAGVTRL KEGDRVGVPW LHTACGCCTP       120
     CRTGWETLCG SQQNTGYSVD GTFAQYGLAD PDFVGTLPAK LEFGPAAPVL CAGVTVYKGL       180
     KETEVRPGEW VLVSGIGGLG HMAVQYAKAM GMHVAAADIF PDKLALAEKL GADLVVDAKA       240
     ADAIEEVQKR TGGVHGALVT AVSPKAMEQA YRMLRSKGTM ALVGLPPSQI CLPVFDTVLK       300
     RITVRGSIVG TRQDLEEALE FAGEGKVGAH FSWDKIENIN AIFERMEEGK IDGRIVLDLN       360
//

If you have problems or comments...

PBIL Back to PBIL home page