(data stored in ACNUC7421 zone)

EMBL: CP001389.PE372

CP001389.PE372       Location/Qualifiers
FT   CDS             425034..425909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03800"
FT                   /product="putative dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24176"
FT                   /db_xref="GOA:C3MGR1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR1"
FT                   /protein_id="ACP24176.1"
FT                   /translation="MNKPVITQAMIDAYDEYTHLTLDRRRFMERLTALAGTAAAAAAIA
FT                   PLLAANSAKAEMVAATDERIKGEDITYPGADGEMKGYLVKPANASGKLPAVIVIHENRG
FT                   LNPHIKDVARRVALDGFVALAPDFLSPDGGTPEDEDKAREMISALDAGETNANAVATVA
FT                   FLKGHAESTGNVGAIGFCWGGGMVNRLAVNSPDLKAGVAYYGSQPKAEDVPKIKAAMLL
FT                   HYAGLDERINAGIDAYRKALTENGKDATIYVYDGVNHAFNNDTSAARYDKAAAELAWGR
FT                   TVEFLKTKLA"
     MNKPVITQAM IDAYDEYTHL TLDRRRFMER LTALAGTAAA AAAIAPLLAA NSAKAEMVAA        60
     TDERIKGEDI TYPGADGEMK GYLVKPANAS GKLPAVIVIH ENRGLNPHIK DVARRVALDG       120
     FVALAPDFLS PDGGTPEDED KAREMISALD AGETNANAVA TVAFLKGHAE STGNVGAIGF       180
     CWGGGMVNRL AVNSPDLKAG VAYYGSQPKA EDVPKIKAAM LLHYAGLDER INAGIDAYRK       240
     ALTENGKDAT IYVYDGVNHA FNNDTSAARY DKAAAELAWG RTVEFLKTKL A                291
//

If you have problems or comments...

PBIL Back to PBIL home page