(data stored in ACNUC7421 zone)

EMBL: CP001389.PE375

CP001389.PE375       Location/Qualifiers
FT   CDS             428188..428484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24179"
FT                   /db_xref="GOA:C3MGR4"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR4"
FT                   /protein_id="ACP24179.1"
FT                   /translation="MRTTQHALDLDLAAGKPSLASRTAGVIGVLTAVWRLYRSRCQIAR
FT                   LHDLDDRQLLDMGLKREDLHEAMTSSFFENPGSFLTRASRNRANHFYRGVRHD"
     MRTTQHALDL DLAAGKPSLA SRTAGVIGVL TAVWRLYRSR CQIARLHDLD DRQLLDMGLK        60
     REDLHEAMTS SFFENPGSFL TRASRNRANH FYRGVRHD                                98
//

If you have problems or comments...

PBIL Back to PBIL home page