(data stored in ACNUC7421 zone)

EMBL: CP001389.PE377

CP001389.PE377       Location/Qualifiers
FT   CDS             complement(429776..431149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03850"
FT                   /product="glutamate-cysteine ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24181"
FT                   /db_xref="GOA:C3MGR6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR6"
FT                   /protein_id="ACP24181.1"
FT                   /translation="MARDTTDQTPVTSVAELTAYLASGSKPKERFRIGTEHEKFAFFKA
FT                   DNSPVPYFGEASIQALLKGMAERNGWEPIVDEGNIIGLAERDGNGAISLEPGGQFELSG
FT                   APLENLHQTCKESNQHLAVLREIAEPLGIRFLGIGGSPKWTFEETPRMPKSRYAIMSRY
FT                   MPKVGTHGLDMMYRTCTIQVNLDFSSEEDMRRKMQVSMKLQSLATALFASSPFTDGKPN
FT                   GLLSWRGEIWRDTDNRRAGLLPASFRPDFGFADYVEWALDVPMYFVVRDGHYHDCTHVT
FT                   FRQFMNGALKGEIAEWQPNMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDQALADAETLTRDWSYDEVQALRDAVPAEGLAAKFRTTSLFDIAREVLAISR
FT                   AGLKRRNRLNGDGIDESQFLEPLGEVLAKKATLAEDLLALYDGRWNRSVDPVFTEYQY"
     MARDTTDQTP VTSVAELTAY LASGSKPKER FRIGTEHEKF AFFKADNSPV PYFGEASIQA        60
     LLKGMAERNG WEPIVDEGNI IGLAERDGNG AISLEPGGQF ELSGAPLENL HQTCKESNQH       120
     LAVLREIAEP LGIRFLGIGG SPKWTFEETP RMPKSRYAIM SRYMPKVGTH GLDMMYRTCT       180
     IQVNLDFSSE EDMRRKMQVS MKLQSLATAL FASSPFTDGK PNGLLSWRGE IWRDTDNRRA       240
     GLLPASFRPD FGFADYVEWA LDVPMYFVVR DGHYHDCTHV TFRQFMNGAL KGEIAEWQPN       300
     MGDWTNHLST LFPDVRLKRF LEMRGADGGP WRRICALPAF WVGLLYDDQA LADAETLTRD       360
     WSYDEVQALR DAVPAEGLAA KFRTTSLFDI AREVLAISRA GLKRRNRLNG DGIDESQFLE       420
     PLGEVLAKKA TLAEDLLALY DGRWNRSVDP VFTEYQY                                457
//

If you have problems or comments...

PBIL Back to PBIL home page