(data stored in ACNUC7421 zone)

EMBL: CP001389.PE378

CP001389.PE378       Location/Qualifiers
FT   CDS             complement(431334..432071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24182"
FT                   /db_xref="GOA:C3MGR7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR7"
FT                   /protein_id="ACP24182.1"
FT                   /translation="MRANFRMQRLFVESPLHAGARHEATKDQFNYLINVLRFGEGSSIL
FT                   VFNGRDGEWRAELSLPSRKQLVLTAVEQTRPQPAPSDLVYLFAPLKTGRLDYLVQKAVE
FT                   MGAGVLQPVMTQHVQGKLGNLDRLRANVTEAAEQCGVLGIPSVETPRKLEELLANWPRE
FT                   RRIIFCDEGNESQNPLPILGGISERRLALLIGPEGGFSEAERVLLHSLDFVTAVPLGPR
FT                   ILRADTAAVAALALIQATLGDWR"
     MRANFRMQRL FVESPLHAGA RHEATKDQFN YLINVLRFGE GSSILVFNGR DGEWRAELSL        60
     PSRKQLVLTA VEQTRPQPAP SDLVYLFAPL KTGRLDYLVQ KAVEMGAGVL QPVMTQHVQG       120
     KLGNLDRLRA NVTEAAEQCG VLGIPSVETP RKLEELLANW PRERRIIFCD EGNESQNPLP       180
     ILGGISERRL ALLIGPEGGF SEAERVLLHS LDFVTAVPLG PRILRADTAA VAALALIQAT       240
     LGDWR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page