(data stored in ACNUC7421 zone)

EMBL: CP001389.PE379

CP001389.PE379       Location/Qualifiers
FT   CDS             complement(432082..433590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03870"
FT                   /product="putative phosphate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24183"
FT                   /db_xref="GOA:C3MGR8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR8"
FT                   /protein_id="ACP24183.1"
FT                   /translation="MSKPRLRLEKLTIDKDLDKVSRAEEASQHVMRGLAAPGLGLLFLI
FT                   LSMAFAASYFTGASGMAIVVAGAAIAAYMAMNIGANDVTNNVGAAVGAKAMTMATALGI
FT                   AAVFEIAGAVIAGRKVTLTIEAGIVDGAQLVSLDVLVWVMMAALLSSAVWINIATYARA
FT                   PVSTTHSIVGGIIGAGMAAEGFASVKWWAIAGITASWSVSPLLGGAIAALFLAFLKEFV
FT                   IYRNDKIAAARYWMPIVLGVTAGSFTAYVAVSALVHLQVISLGTGLLIGTLAGIACYGL
FT                   CKPWIHRQSAGLENRNQSLRKLFRLPLIFSAALLSFAHGANDVSNAIGPLSAIVSAVNG
FT                   TISTARSEAPFWVLLIGALGISMGLLLYGPILIRVVGEEITRLNPMRAFCVALATAVTV
FT                   LLASALGLPISSTHTAVGAVFGVGFFREWYIRHSRRRLEYIRRRTGQTGFMGEAIETNF
FT                   AEVRRRRLVRRSYFLTIVAAWVITLPASALLSALVYRLLAGLFL"
     MSKPRLRLEK LTIDKDLDKV SRAEEASQHV MRGLAAPGLG LLFLILSMAF AASYFTGASG        60
     MAIVVAGAAI AAYMAMNIGA NDVTNNVGAA VGAKAMTMAT ALGIAAVFEI AGAVIAGRKV       120
     TLTIEAGIVD GAQLVSLDVL VWVMMAALLS SAVWINIATY ARAPVSTTHS IVGGIIGAGM       180
     AAEGFASVKW WAIAGITASW SVSPLLGGAI AALFLAFLKE FVIYRNDKIA AARYWMPIVL       240
     GVTAGSFTAY VAVSALVHLQ VISLGTGLLI GTLAGIACYG LCKPWIHRQS AGLENRNQSL       300
     RKLFRLPLIF SAALLSFAHG ANDVSNAIGP LSAIVSAVNG TISTARSEAP FWVLLIGALG       360
     ISMGLLLYGP ILIRVVGEEI TRLNPMRAFC VALATAVTVL LASALGLPIS STHTAVGAVF       420
     GVGFFREWYI RHSRRRLEYI RRRTGQTGFM GEAIETNFAE VRRRRLVRRS YFLTIVAAWV       480
     ITLPASALLS ALVYRLLAGL FL                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page