(data stored in ACNUC7421 zone)

EMBL: CP001389.PE380

CP001389.PE380       Location/Qualifiers
FT   CDS             complement(433802..434308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03880"
FT                   /product="putative NTP pyrophosphohydrolase protein,
FT                   MuT/nudix family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24184"
FT                   /db_xref="GOA:C3MGR9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR9"
FT                   /protein_id="ACP24184.1"
FT                   /translation="MNFLHRLASDVHLMMRRPARMQYAALCYRIRKKTVSPEILLLTSR
FT                   DTGRWVIPKGWPMQGKWAHEVAEREAYEEAGVKGKAQKAAIGSYVYQKRMDHGLKIPCK
FT                   VQVHALEVDNLCKNFPEKGERKLEWVDYAEAARRVAEPSLKELILGFGKRMAAAQPPEP
FT                   AASEG"
     MNFLHRLASD VHLMMRRPAR MQYAALCYRI RKKTVSPEIL LLTSRDTGRW VIPKGWPMQG        60
     KWAHEVAERE AYEEAGVKGK AQKAAIGSYV YQKRMDHGLK IPCKVQVHAL EVDNLCKNFP       120
     EKGERKLEWV DYAEAARRVA EPSLKELILG FGKRMAAAQP PEPAASEG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page