(data stored in ACNUC7421 zone)

EMBL: CP001389.PE383

CP001389.PE383       Location/Qualifiers
FT   CDS             complement(436862..437758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03910"
FT                   /product="putative transcriptional regulator protein, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24187"
FT                   /db_xref="GOA:C3MGS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS2"
FT                   /protein_id="ACP24187.1"
FT                   /translation="MTNLGDLEVFARVVSTGSMSAAGRALGLSAAVISKRVKRLEERLG
FT                   TRLLQRTTRQVSLTEAGQGFYDRVLGVLAGIEEAEAYAAGRSSQAQGTLRITAPTSFGR
FT                   MHIAPHLTGFMKDHPDLKLHIVLSDEFSDIVADGFDLAVRIGELTDSSLVARKLAPVRR
FT                   LLCASPDYISRHGAPKEIGDLAEHICLPAHNNESWKLEGPGGSLAYRPDGPLVTNSSEI
FT                   IRAAVIAGAGIALRSTWDVSAELRDGHLVQVLPEWEGSQRLTLSAVYPSRQFLPAKVRL
FT                   FVDYLSALYGPVPYWEQ"
     MTNLGDLEVF ARVVSTGSMS AAGRALGLSA AVISKRVKRL EERLGTRLLQ RTTRQVSLTE        60
     AGQGFYDRVL GVLAGIEEAE AYAAGRSSQA QGTLRITAPT SFGRMHIAPH LTGFMKDHPD       120
     LKLHIVLSDE FSDIVADGFD LAVRIGELTD SSLVARKLAP VRRLLCASPD YISRHGAPKE       180
     IGDLAEHICL PAHNNESWKL EGPGGSLAYR PDGPLVTNSS EIIRAAVIAG AGIALRSTWD       240
     VSAELRDGHL VQVLPEWEGS QRLTLSAVYP SRQFLPAKVR LFVDYLSALY GPVPYWEQ         298
//

If you have problems or comments...

PBIL Back to PBIL home page