(data stored in ACNUC7421 zone)

EMBL: CP001389.PE386

CP001389.PE386       Location/Qualifiers
FT   CDS             440918..441298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24190"
FT                   /db_xref="GOA:C3MGS5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS5"
FT                   /protein_id="ACP24190.1"
FT                   /translation="MPDPGPQTPLSRDTDRWLEPGKVNIQIIYLLYLVGFAIGVTVLVG
FT                   IVLAYLNRDKAEPWARTHYTWAIRTFWIALLFAVVSALLSVLLIGVLGFIATAVWIVVR
FT                   CVIGLQKAAREEPITDPESWLV"
     MPDPGPQTPL SRDTDRWLEP GKVNIQIIYL LYLVGFAIGV TVLVGIVLAY LNRDKAEPWA        60
     RTHYTWAIRT FWIALLFAVV SALLSVLLIG VLGFIATAVW IVVRCVIGLQ KAAREEPITD       120
     PESWLV                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page