(data stored in ACNUC7421 zone)

EMBL: CP001389.PE387

CP001389.PE387       Location/Qualifiers
FT   CDS             441360..442655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03950"
FT                   /product="glycolate oxidase, iron-sulphur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24191"
FT                   /db_xref="GOA:C3MGS6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS6"
FT                   /protein_id="ACP24191.1"
FT                   /translation="MQTNFSREQLADPHVAESEKILRKCVHCGFCTATCPTYVLLGDEL
FT                   DSPRGRIYLIKDMLENGRAADAETVTHIDRCLSCLSCMTTCPSGVDYMHLVDHARVHIE
FT                   KTYKRPLKDRFARSVIAATLPYPSRFRLALRAARLARPLAGLLKRVAWLRTFGVMLDLA
FT                   PRAMPTASDGARAAVYAAKGTPRGRVALLTGCAQPVLRPEINEATVRLLTGQGVEVVVS
FT                   AGEGCCGALVHHMGREEQALDAARRNVDVWLKAADEDGLDAIVITASGCGTTIKDYGHM
FT                   LRLDPAYAEKAAKVSALAKDITEYLAGLDLPEQGARGMTVAYHSACSMQHGQKITLAPK
FT                   QLLKRAGFAVREPAEGHLCCGSAGTYNILQPEISAKLKARKVRNIEATKPNVIATGNIG
FT                   CITQIAGGTNIPILHTVELLDWAYGGPKPAGL"
     MQTNFSREQL ADPHVAESEK ILRKCVHCGF CTATCPTYVL LGDELDSPRG RIYLIKDMLE        60
     NGRAADAETV THIDRCLSCL SCMTTCPSGV DYMHLVDHAR VHIEKTYKRP LKDRFARSVI       120
     AATLPYPSRF RLALRAARLA RPLAGLLKRV AWLRTFGVML DLAPRAMPTA SDGARAAVYA       180
     AKGTPRGRVA LLTGCAQPVL RPEINEATVR LLTGQGVEVV VSAGEGCCGA LVHHMGREEQ       240
     ALDAARRNVD VWLKAADEDG LDAIVITASG CGTTIKDYGH MLRLDPAYAE KAAKVSALAK       300
     DITEYLAGLD LPEQGARGMT VAYHSACSMQ HGQKITLAPK QLLKRAGFAV REPAEGHLCC       360
     GSAGTYNILQ PEISAKLKAR KVRNIEATKP NVIATGNIGC ITQIAGGTNI PILHTVELLD       420
     WAYGGPKPAG L                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page