(data stored in ACNUC7421 zone)

EMBL: CP001389.PE388

CP001389.PE388       Location/Qualifiers
FT   CDS             complement(442717..443412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03960"
FT                   /product="putative exported ErfK/YbiS/YhnG protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24192"
FT                   /db_xref="GOA:C3MGS7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS7"
FT                   /protein_id="ACP24192.1"
FT                   /translation="MRLHATRLAALTVAAAAFLAAANASAFTPADIVGAKVKRSDVVLA
FT                   AQPKKPPQRFWRTKVRFRTDEAPGTVIVDTNNKYLYYIDGPNRATRYGIGVGREGFGWS
FT                   GVVKVGRKAEWPAWTPPAEMRQREKEKGRILPITQEGGIDNPLGARALYLYKGGRDTIF
FT                   RIHGTNQPWTIGQNMSSGCIRMMNEDVEHLYERAPIGTKVIVIGPGNKQGDVSYDDRGV
FT                   DIFRQIFGG"
     MRLHATRLAA LTVAAAAFLA AANASAFTPA DIVGAKVKRS DVVLAAQPKK PPQRFWRTKV        60
     RFRTDEAPGT VIVDTNNKYL YYIDGPNRAT RYGIGVGREG FGWSGVVKVG RKAEWPAWTP       120
     PAEMRQREKE KGRILPITQE GGIDNPLGAR ALYLYKGGRD TIFRIHGTNQ PWTIGQNMSS       180
     GCIRMMNEDV EHLYERAPIG TKVIVIGPGN KQGDVSYDDR GVDIFRQIFG G                231
//

If you have problems or comments...

PBIL Back to PBIL home page