(data stored in ACNUC7421 zone)

EMBL: CP001389.PE389

CP001389.PE389       Location/Qualifiers
FT   CDS             complement(443721..444470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03970"
FT                   /product="putative exported ErfK/YbiS/YhnG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24193"
FT                   /db_xref="GOA:C3MGS8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS8"
FT                   /protein_id="ACP24193.1"
FT                   /translation="MMKKFLLLATCLVCTLPAGAGASDRYRNRPPVIVSPDLTAPWVMQ
FT                   LTGEGVRPAVYRPQAPAATRKQVERRPTKRRLETAAVQPAAAHRAQKPLKSQFDPQFLP
FT                   QMVAYDTGEKPGTIVIDTNNRFLYLVTGDGQARRYGVGVGKPGFEWAGAHKITRKSEWP
FT                   SWTPPGEMIAREAAKGHYLPDRMDGGPANPLGARAMYLGSTLYRIHGTNAPWTIGYGVS
FT                   SGCIRMRNEDVVDLYERVKIGTKVIVI"
     MMKKFLLLAT CLVCTLPAGA GASDRYRNRP PVIVSPDLTA PWVMQLTGEG VRPAVYRPQA        60
     PAATRKQVER RPTKRRLETA AVQPAAAHRA QKPLKSQFDP QFLPQMVAYD TGEKPGTIVI       120
     DTNNRFLYLV TGDGQARRYG VGVGKPGFEW AGAHKITRKS EWPSWTPPGE MIAREAAKGH       180
     YLPDRMDGGP ANPLGARAMY LGSTLYRIHG TNAPWTIGYG VSSGCIRMRN EDVVDLYERV       240
     KIGTKVIVI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page