(data stored in ACNUC7421 zone)

EMBL: CP001389.PE39

CP001389.PE39        Location/Qualifiers
FT   CDS             41673..42170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00390"
FT                   /product="predicted ribosomal-protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23843"
FT                   /db_xref="GOA:C3MF06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF06"
FT                   /protein_id="ACP23843.1"
FT                   /translation="MSFTDYFTRRTEFDIFPLEEIDLLAAAALHSQRFATPWSDGEIHA
FT                   LLLQDAVFGFAARQTNGAFRPALGGFVLSRAAAGEAEILTIGVDSRFARSGLGWRLMQA
FT                   AMREAIVKGAETLFLEVDETNLAAIGLYGKLGFARVGERKAYYKGTAGARTAALVMRLD
FT                   LR"
     MSFTDYFTRR TEFDIFPLEE IDLLAAAALH SQRFATPWSD GEIHALLLQD AVFGFAARQT        60
     NGAFRPALGG FVLSRAAAGE AEILTIGVDS RFARSGLGWR LMQAAMREAI VKGAETLFLE       120
     VDETNLAAIG LYGKLGFARV GERKAYYKGT AGARTAALVM RLDLR                       165
//

If you have problems or comments...

PBIL Back to PBIL home page