(data stored in ACNUC7421 zone)

EMBL: CP001389.PE391

CP001389.PE391       Location/Qualifiers
FT   CDS             complement(445383..445754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24195"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT0"
FT                   /protein_id="ACP24195.1"
FT                   /translation="MSLKRILTALMIAASIGSPALSQESGHQGMKHDATAAEPAPSSRA
FT                   FAEANAKMHKDMDIDFTGNADVDFVRGMIAHHQGAIDMAKVELEYGKDEAIRKLAETII
FT                   KVQEGEIKMMKEWLAGHGG"
     MSLKRILTAL MIAASIGSPA LSQESGHQGM KHDATAAEPA PSSRAFAEAN AKMHKDMDID        60
     FTGNADVDFV RGMIAHHQGA IDMAKVELEY GKDEAIRKLA ETIIKVQEGE IKMMKEWLAG       120
     HGG                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page