(data stored in ACNUC7421 zone)

EMBL: CP001389.PE392

CP001389.PE392       Location/Qualifiers
FT   CDS             complement(446262..446690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT1"
FT                   /protein_id="ACP24196.1"
FT                   /translation="MLTVMTPGAAAIRPLNPETHGAWTRALAKAGYVIDRWHCDVDSGA
FT                   FVVGLRTLSLLGLRQNPCGIIDLVRAYDQEDRATILSILEQATATSSSFCFSAMVRRPS
FT                   GSAYQLCCIGNSTLGAHGAGGSLQGVFAVPRSRSALPA"
     MLTVMTPGAA AIRPLNPETH GAWTRALAKA GYVIDRWHCD VDSGAFVVGL RTLSLLGLRQ        60
     NPCGIIDLVR AYDQEDRATI LSILEQATAT SSSFCFSAMV RRPSGSAYQL CCIGNSTLGA       120
     HGAGGSLQGV FAVPRSRSAL PA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page