(data stored in ACNUC7421 zone)

EMBL: CP001389.PE394

CP001389.PE394       Location/Qualifiers
FT   CDS             448487..449626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04020"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24198"
FT                   /db_xref="GOA:C3MGT3"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGT3"
FT                   /protein_id="ACP24198.1"
FT                   /translation="MPLINLPAFAGDLLADFERLKTLRVDTPVIQPAEPFLDMAGEDLR
FT                   RRIFMTQSETGDSLCLRPEFTIPVCLRHIETATGTPQRYAYLGEVFRQRREGSSEFYQA
FT                   GIEDLGDTDTAGADARAIGDAMRVLSNRLANRRLKVTLGDQSVFEAVIAACGLPGGWQK
FT                   RLIHAFGDPKQLQKLLGELADPKSPGVFGHEVERLAILGILDDEERLVAHLAETMEATG
FT                   YSTNASRSPRDIARRLKEKMELATTRLDRAALAVMREFLAFDLPLSEAPAALHAFAKKS
FT                   RLKIDDALSLFDARVAAIAKVGAESDLIRYRAAFGRPLDYYTGLVFEIEAEGAPAVLAG
FT                   GGRFDRLLTLLGAREHIPAVGFSLWLDRIERAIAAAGGA"
     MPLINLPAFA GDLLADFERL KTLRVDTPVI QPAEPFLDMA GEDLRRRIFM TQSETGDSLC        60
     LRPEFTIPVC LRHIETATGT PQRYAYLGEV FRQRREGSSE FYQAGIEDLG DTDTAGADAR       120
     AIGDAMRVLS NRLANRRLKV TLGDQSVFEA VIAACGLPGG WQKRLIHAFG DPKQLQKLLG       180
     ELADPKSPGV FGHEVERLAI LGILDDEERL VAHLAETMEA TGYSTNASRS PRDIARRLKE       240
     KMELATTRLD RAALAVMREF LAFDLPLSEA PAALHAFAKK SRLKIDDALS LFDARVAAIA       300
     KVGAESDLIR YRAAFGRPLD YYTGLVFEIE AEGAPAVLAG GGRFDRLLTL LGAREHIPAV       360
     GFSLWLDRIE RAIAAAGGA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page