(data stored in ACNUC7421 zone)

EMBL: CP001389.PE397

CP001389.PE397       Location/Qualifiers
FT   CDS             451287..452504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04050"
FT                   /product="putative ferredoxin reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24201"
FT                   /db_xref="GOA:C3MGT6"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT6"
FT                   /protein_id="ACP24201.1"
FT                   /translation="MSGRLVVIGGGQAAFALVAKLRALQDTRPITVIAAESSLPYQRPP
FT                   LSKKYLLREMTLDRLLYRPEAWYAEHGIDIRLSTSVTRVDRRASEVTLSDGSRLAYETL
FT                   AFATGATPRRLPASIGGDLAGVYVVRDFRDADRLAEEMKPGRRALVIGGGYIGLEAAAV
FT                   ARTCGLEVTVIEMADRILQRVASAATSAIVREIHRSHGVDIRERMGLHRLIGDNGPVTA
FT                   AELSDGSVIPVDVVIVGIGVGANDALAHDAGLETANGILVDGHGRTSDPAIFAIGDCAV
FT                   LPWQGMRIRLESVQNAVDQAEAVAAILAGGTAPYDPKPWFWSDQYDVKLQIAGFGLGHD
FT                   ETLVRPGQREGSVSVWYFRQGKLIAVDAINDAKAYVTGKKLLEAGVTPDPALLADPQVD
FT                   LKSLLA"
     MSGRLVVIGG GQAAFALVAK LRALQDTRPI TVIAAESSLP YQRPPLSKKY LLREMTLDRL        60
     LYRPEAWYAE HGIDIRLSTS VTRVDRRASE VTLSDGSRLA YETLAFATGA TPRRLPASIG       120
     GDLAGVYVVR DFRDADRLAE EMKPGRRALV IGGGYIGLEA AAVARTCGLE VTVIEMADRI       180
     LQRVASAATS AIVREIHRSH GVDIRERMGL HRLIGDNGPV TAAELSDGSV IPVDVVIVGI       240
     GVGANDALAH DAGLETANGI LVDGHGRTSD PAIFAIGDCA VLPWQGMRIR LESVQNAVDQ       300
     AEAVAAILAG GTAPYDPKPW FWSDQYDVKL QIAGFGLGHD ETLVRPGQRE GSVSVWYFRQ       360
     GKLIAVDAIN DAKAYVTGKK LLEAGVTPDP ALLADPQVDL KSLLA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page