(data stored in ACNUC7421 zone)

EMBL: CP001389.PE398

CP001389.PE398       Location/Qualifiers
FT   CDS             452726..455512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04060"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS domain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24202"
FT                   /db_xref="GOA:C3MGT7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT7"
FT                   /protein_id="ACP24202.1"
FT                   /translation="MFKILSCLVVEHDLRLVALAAIICALSSYGAVTLLQRARLSRGGP
FT                   RAIWLGAAGIASGFGIWATHFIAMLAYDPGVVLGYHTSLTTLSLVVAILLTTTALAIAT
FT                   YAKGRPAWLLGGLVLGAGVGCMHFLGMAALELPGFIRWDRTLVVASVLAGVLFEMVAIF
FT                   AIKRDQSKAQLAATAAMTLGIVVLHFTAMGAVTMEVEFATGIQEGMIQPHFLAFVLAGT
FT                   AFFLLSAVLIAAGFARHAEILAVASEKEFSRFVGSVKDYAIYMLDVDGRVASWNAGAEA
FT                   NKGYTAEEIVGKNFACFYSPEDQAANLPARALRIALEAGQYETEGWRYRKDGTRFWAHV
FT                   VIDTIVGEDGGHAGFIKIAKDITKRKEDADRIAEVSKNLDIALENMTQGICLFDHADRL
FT                   LISNRRCLEIFELPESLAGFGLTFREVLDRMCARTYPDPAVAEAKSEAAYRKHRLEIAG
FT                   KGGGDFVEKLSNGRSILVKHRTLPDGGWVSTYEDITERLDSEEQISFLARHDSLTGLPN
FT                   RLQFNSHLDEELDAAVWFSRKVAVIGIDLDKFKEVNDLHGHAAGDFVLVTIAQRMKEHL
FT                   QEGEFVARFGGDEFAAVKRFEDLSEVHDFLRRIETCLQEEMRFGDFELKSGGSMGVAIY
FT                   PQDAETADTLINNADLAMYRAKAALNQTICFYEVSMDEAARGRRALANDLWEAVERSEL
FT                   ALHYQVQKSVTTGDVIGYEVLLRWNHPERGLVPPNEFIPLAEECGAILPIGEWVLRQAC
FT                   REAASWDAEYKIAVNLSPVQLANGDVVSLVHSILVETGLDAKRLELEITESTIIDDKER
FT                   ALLTLRAIKALGVTIAIDDFGTGYSSLETLRAFPFDKIKLDKSFMSEVEGSPQAKAIIR
FT                   AILALGHSLQVPVLAEGVETQKQLDILQAEGCDEAQGYLLGRPAPIGSVVGVRTEAA"
     MFKILSCLVV EHDLRLVALA AIICALSSYG AVTLLQRARL SRGGPRAIWL GAAGIASGFG        60
     IWATHFIAML AYDPGVVLGY HTSLTTLSLV VAILLTTTAL AIATYAKGRP AWLLGGLVLG       120
     AGVGCMHFLG MAALELPGFI RWDRTLVVAS VLAGVLFEMV AIFAIKRDQS KAQLAATAAM       180
     TLGIVVLHFT AMGAVTMEVE FATGIQEGMI QPHFLAFVLA GTAFFLLSAV LIAAGFARHA       240
     EILAVASEKE FSRFVGSVKD YAIYMLDVDG RVASWNAGAE ANKGYTAEEI VGKNFACFYS       300
     PEDQAANLPA RALRIALEAG QYETEGWRYR KDGTRFWAHV VIDTIVGEDG GHAGFIKIAK       360
     DITKRKEDAD RIAEVSKNLD IALENMTQGI CLFDHADRLL ISNRRCLEIF ELPESLAGFG       420
     LTFREVLDRM CARTYPDPAV AEAKSEAAYR KHRLEIAGKG GGDFVEKLSN GRSILVKHRT       480
     LPDGGWVSTY EDITERLDSE EQISFLARHD SLTGLPNRLQ FNSHLDEELD AAVWFSRKVA       540
     VIGIDLDKFK EVNDLHGHAA GDFVLVTIAQ RMKEHLQEGE FVARFGGDEF AAVKRFEDLS       600
     EVHDFLRRIE TCLQEEMRFG DFELKSGGSM GVAIYPQDAE TADTLINNAD LAMYRAKAAL       660
     NQTICFYEVS MDEAARGRRA LANDLWEAVE RSELALHYQV QKSVTTGDVI GYEVLLRWNH       720
     PERGLVPPNE FIPLAEECGA ILPIGEWVLR QACREAASWD AEYKIAVNLS PVQLANGDVV       780
     SLVHSILVET GLDAKRLELE ITESTIIDDK ERALLTLRAI KALGVTIAID DFGTGYSSLE       840
     TLRAFPFDKI KLDKSFMSEV EGSPQAKAII RAILALGHSL QVPVLAEGVE TQKQLDILQA       900
     EGCDEAQGYL LGRPAPIGSV VGVRTEAA                                          928
//

If you have problems or comments...

PBIL Back to PBIL home page