(data stored in ACNUC7421 zone)

EMBL: CP001389.PE399

CP001389.PE399       Location/Qualifiers
FT   CDS             455611..455964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24203"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT8"
FT                   /protein_id="ACP24203.1"
FT                   /translation="MRAADAALLDPCDKHRDEGERAFAKPNYATVVYLASERPRRCEGR
FT                   YGLGLVIMRDELGRGSPNRTRFPRERMILKKLPQKYPTAKRAAREPPFDPDGSPVLRLS
FT                   PCHIMSVPPVQRA"
     MRAADAALLD PCDKHRDEGE RAFAKPNYAT VVYLASERPR RCEGRYGLGL VIMRDELGRG        60
     SPNRTRFPRE RMILKKLPQK YPTAKRAARE PPFDPDGSPV LRLSPCHIMS VPPVQRA          117
//

If you have problems or comments...

PBIL Back to PBIL home page