(data stored in ACNUC7421 zone)

EMBL: CP001389.PE4

CP001389.PE4         Location/Qualifiers
FT   CDS             3527..4009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00040"
FT                   /product="hypothetical protein"
FT                   /note="similar to activator of Hsp90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23808"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI5"
FT                   /protein_id="ACP23808.1"
FT                   /translation="MTAATDTRPADERDLVLIRLIDAPREKVYRAFTDPELLKQWFAPL
FT                   PWTITEAELDVRPGGTNRFVMRSPEGELYPNQGVYLEVVPNEKLVMSDAYTEAWTPSEK
FT                   PFMTAILTFEEEGGKTRYTARARHWSTADREAHEKMGFHEGWGQCADQLAALVAKL"
     MTAATDTRPA DERDLVLIRL IDAPREKVYR AFTDPELLKQ WFAPLPWTIT EAELDVRPGG        60
     TNRFVMRSPE GELYPNQGVY LEVVPNEKLV MSDAYTEAWT PSEKPFMTAI LTFEEEGGKT       120
     RYTARARHWS TADREAHEKM GFHEGWGQCA DQLAALVAKL                             160
//

If you have problems or comments...

PBIL Back to PBIL home page