(data stored in ACNUC7421 zone)

EMBL: CP001389.PE402

CP001389.PE402       Location/Qualifiers
FT   CDS             458414..459241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04100"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24206"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU1"
FT                   /protein_id="ACP24206.1"
FT                   /translation="MASFNSISPEKLSRLVGTPKGPVLIDVRDEDDFTADPHLVPSSFH
FT                   RPHADAPTWADEYKGQWVVVLCKHGGKLSEGVAAWLRLAGAAAEILEGGLEGWREADLP
FT                   LVPVASLPKAAASGGSVWVTRARPKIDRIACPWLIRRFVDPHARFLYVTPAEVEAVGER
FT                   FGATPFDIEGVFWSHRGDDCTFDTMVKEFRLSFPALEHVARIVRGADTDRHDLEPQAAG
FT                   LLAVSLGLSRMYTDDLEQLEAGMTLYDALYRWARDATQEKHDWVSHGGKGKRT"
     MASFNSISPE KLSRLVGTPK GPVLIDVRDE DDFTADPHLV PSSFHRPHAD APTWADEYKG        60
     QWVVVLCKHG GKLSEGVAAW LRLAGAAAEI LEGGLEGWRE ADLPLVPVAS LPKAAASGGS       120
     VWVTRARPKI DRIACPWLIR RFVDPHARFL YVTPAEVEAV GERFGATPFD IEGVFWSHRG       180
     DDCTFDTMVK EFRLSFPALE HVARIVRGAD TDRHDLEPQA AGLLAVSLGL SRMYTDDLEQ       240
     LEAGMTLYDA LYRWARDATQ EKHDWVSHGG KGKRT                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page