(data stored in ACNUC7421 zone)

EMBL: CP001389.PE403

CP001389.PE403       Location/Qualifiers
FT   CDS             459238..460596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04110"
FT                   /product="Chromate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24207"
FT                   /db_xref="GOA:C3MGU2"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU2"
FT                   /protein_id="ACP24207.1"
FT                   /translation="MNEQSSAGLAPAHPSFAEATKVWAKIGLLSFGGPAGQIALMHREL
FT                   VEERRWISESRFLHALNYCMLLPGPEAQQLATYIGWLLHGTRGGVVAGTLFVVPGFFVI
FT                   LALSSAYALFQETNWLASLFFGLKAAVLAIVIEALIRLSRRALKTGFDRVLAIVAFLAL
FT                   FAFGLPFPLVVVAAGVAGYVAARHAPARRDAAHAAKAPDLPSVIGADYPDGKPTWGRAA
FT                   AVVAVWGALWLAPFALIFATVGGKNVYTDVGVFFSQMAVVTFGGAYAVLAYVAQQAVET
FT                   YHWLQPGEMVDGLALAETTPGPLVLVLAFVGFMGAYRAPIGVDPLTSGMLGATLATWVT
FT                   FVPCFMWIFLGAPYVERLRANVALSGALSAISAAVAGVILNLAVWFGLHVLFGRVERLE
FT                   AGPLSLPYPDPTTLHPAALFLTILAAASLLWWKRGVFQTLAICAAAGWLLMLV"
     MNEQSSAGLA PAHPSFAEAT KVWAKIGLLS FGGPAGQIAL MHRELVEERR WISESRFLHA        60
     LNYCMLLPGP EAQQLATYIG WLLHGTRGGV VAGTLFVVPG FFVILALSSA YALFQETNWL       120
     ASLFFGLKAA VLAIVIEALI RLSRRALKTG FDRVLAIVAF LALFAFGLPF PLVVVAAGVA       180
     GYVAARHAPA RRDAAHAAKA PDLPSVIGAD YPDGKPTWGR AAAVVAVWGA LWLAPFALIF       240
     ATVGGKNVYT DVGVFFSQMA VVTFGGAYAV LAYVAQQAVE TYHWLQPGEM VDGLALAETT       300
     PGPLVLVLAF VGFMGAYRAP IGVDPLTSGM LGATLATWVT FVPCFMWIFL GAPYVERLRA       360
     NVALSGALSA ISAAVAGVIL NLAVWFGLHV LFGRVERLEA GPLSLPYPDP TTLHPAALFL       420
     TILAAASLLW WKRGVFQTLA ICAAAGWLLM LV                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page