(data stored in ACNUC7421 zone)

EMBL: CP001389.PE407

CP001389.PE407       Location/Qualifiers
FT   CDS             465869..466492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24211"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU6"
FT                   /protein_id="ACP24211.1"
FT                   /translation="MEMTRELRVFAGIAAVVAGSLVLSGCIGGPTYGTDKSAGEQLVDD
FT                   LGSAISLAPPKKDPVKYQPRAGLVLPPQQGEQAALIQPQQSLANREANPAWVESPEEVR
FT                   NRLREEADANKNNPNYVSPLAKASANGRRLSAKEQQAAYREARKIEMGAYSDKRRFLSD
FT                   PPLEYRRLPEGAETDLGEAEKDKERRRKKAAQVANSGSKWYWPF"
     MEMTRELRVF AGIAAVVAGS LVLSGCIGGP TYGTDKSAGE QLVDDLGSAI SLAPPKKDPV        60
     KYQPRAGLVL PPQQGEQAAL IQPQQSLANR EANPAWVESP EEVRNRLREE ADANKNNPNY       120
     VSPLAKASAN GRRLSAKEQQ AAYREARKIE MGAYSDKRRF LSDPPLEYRR LPEGAETDLG       180
     EAEKDKERRR KKAAQVANSG SKWYWPF                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page