(data stored in ACNUC7421 zone)

EMBL: CP001389.PE408

CP001389.PE408       Location/Qualifiers
FT   CDS             466496..466975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04160"
FT                   /product="putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24212"
FT                   /db_xref="GOA:C3MGU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU7"
FT                   /protein_id="ACP24212.1"
FT                   /translation="MAIGIRDAVPDDAATILRFITELATYEKAEHEVEATVELLTASLF
FT                   GPDRVSRAVICEVDGAPAGFAIWFYNYSTWQARKGLYLEDLYVTPEHRGSGAGKMLLKH
FT                   LARIAIAEGCGRFEWSVLDWNEPAIRVYEAIGAEPLSEWTRYRLVGKELEALAAS"
     MAIGIRDAVP DDAATILRFI TELATYEKAE HEVEATVELL TASLFGPDRV SRAVICEVDG        60
     APAGFAIWFY NYSTWQARKG LYLEDLYVTP EHRGSGAGKM LLKHLARIAI AEGCGRFEWS       120
     VLDWNEPAIR VYEAIGAEPL SEWTRYRLVG KELEALAAS                              159
//

If you have problems or comments...

PBIL Back to PBIL home page