(data stored in ACNUC7421 zone)

EMBL: CP001389.PE410

CP001389.PE410       Location/Qualifiers
FT   CDS             467508..469331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04180"
FT                   /product="pseudouridylate synthase, subunit B protein"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24214"
FT                   /db_xref="GOA:C3MGU9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU9"
FT                   /protein_id="ACP24214.1"
FT                   /translation="MTFKDKSTGPGKGKGRKGNYSSGEKKANAARPGNAAPKADAGLDE
FT                   PQRISKILSRAGVASRRDIERMIMEGRVKLNGVVLETPVVNATLADQIEVDGHPIRGIE
FT                   RTRLWLYYKPAGLVTTNSDPEGRPTVFDNLPDELPRVLSVGRLDINTEGLLLLTNDGGL
FT                   ARALELPSTGWLRRYRVRAHGEIDQEALDRLKEGIAVDGVLYGAIEATLDRVQGSNVWI
FT                   TMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLGELPEGHVQEIRGRTLRDQLGPR
FT                   LIAESKANFDAPLYNDQPAAPEREAHNEVAPEWGKERSARREKPEDKRERALARLDTQR
FT                   DDSRSRDRRERPREKFEDRPARPPAKRSRTANVWMAPGARPVAEKKPKGAEEDTSPKPA
FT                   RRERPEGAPKTKRYGRTKDGAATKTSAKFDPDRKARPAKADARPDRAPRPPVKRADEDG
FT                   DWISASEPVRRKDEARDGGFERRRPFDSGERKSRDHGDRPPRREGSERPRGERPARAAG
FT                   DSRAFSEKPRTSRSKDDRPQGREGGDRPFGDRPRGKAPGGKPAGGKSFGQRSGGPRGGG
FT                   KPGGGKPGGGRPGGGKPGGRTGGGKPRGKGK"
     MTFKDKSTGP GKGKGRKGNY SSGEKKANAA RPGNAAPKAD AGLDEPQRIS KILSRAGVAS        60
     RRDIERMIME GRVKLNGVVL ETPVVNATLA DQIEVDGHPI RGIERTRLWL YYKPAGLVTT       120
     NSDPEGRPTV FDNLPDELPR VLSVGRLDIN TEGLLLLTND GGLARALELP STGWLRRYRV       180
     RAHGEIDQEA LDRLKEGIAV DGVLYGAIEA TLDRVQGSNV WITMGLREGK NREIKNVLGA       240
     LGLDVNRLIR ISYGPFQLGE LPEGHVQEIR GRTLRDQLGP RLIAESKANF DAPLYNDQPA       300
     APEREAHNEV APEWGKERSA RREKPEDKRE RALARLDTQR DDSRSRDRRE RPREKFEDRP       360
     ARPPAKRSRT ANVWMAPGAR PVAEKKPKGA EEDTSPKPAR RERPEGAPKT KRYGRTKDGA       420
     ATKTSAKFDP DRKARPAKAD ARPDRAPRPP VKRADEDGDW ISASEPVRRK DEARDGGFER       480
     RRPFDSGERK SRDHGDRPPR REGSERPRGE RPARAAGDSR AFSEKPRTSR SKDDRPQGRE       540
     GGDRPFGDRP RGKAPGGKPA GGKSFGQRSG GPRGGGKPGG GKPGGGRPGG GKPGGRTGGG       600
     KPRGKGK                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page