(data stored in ACNUC7421 zone)

EMBL: CP001389.PE411

CP001389.PE411       Location/Qualifiers
FT   CDS             469338..469895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04190"
FT                   /product="putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24215"
FT                   /db_xref="GOA:C3MGV0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV0"
FT                   /protein_id="ACP24215.1"
FT                   /translation="MRIVGGEFRGRALATPKSNDIRPTTDRTRESLFNILSHGYPGVLD
FT                   GGRVLDLFAGTGAVGLEALSRGCRQALFVEQGVEGRGLIRVNIEALGLQGRAKIFRRDA
FT                   VDLGPVGTMEPFHLVFADPPYGKGLGERALASAAAGGWLVPGALVVLEEQADVRPQLSA
FT                   AFEPLDDRAFGDTRMHFYRFLG"
     MRIVGGEFRG RALATPKSND IRPTTDRTRE SLFNILSHGY PGVLDGGRVL DLFAGTGAVG        60
     LEALSRGCRQ ALFVEQGVEG RGLIRVNIEA LGLQGRAKIF RRDAVDLGPV GTMEPFHLVF       120
     ADPPYGKGLG ERALASAAAG GWLVPGALVV LEEQADVRPQ LSAAFEPLDD RAFGDTRMHF       180
     YRFLG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page