(data stored in ACNUC7421 zone)

EMBL: CP001389.PE412

CP001389.PE412       Location/Qualifiers
FT   CDS             469980..470864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04200"
FT                   /product="putative patatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24216"
FT                   /db_xref="GOA:C3MGV1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV1"
FT                   /protein_id="ACP24216.1"
FT                   /translation="MEQHVADRRDRSDTKGEPMIAVAFGGGGARGLAHIHVIEALDEMG
FT                   IRPSAIAGSSIGAIMGAGMAAGMTGREIRDYTLATVGNRGEVLNRLWQLRPNSLSEAVS
FT                   SGFRFGQFNIERVLKAFLPGAIPARFSDLLIPLKVTATDYYGQSERICESGDLHKAIAA
FT                   SCALPAIFMPVKIEGRVMIDGGMYNPIPFDHLRELADIVIAVDVVGGPDGDGKTIPSRI
FT                   DSLFGASQLMMQSIIAMKMKAGAPDILLRPEVGRFRALDFLRARDVLAATASTKEQLKR
FT                   ALSERIDQWQAGR"
     MEQHVADRRD RSDTKGEPMI AVAFGGGGAR GLAHIHVIEA LDEMGIRPSA IAGSSIGAIM        60
     GAGMAAGMTG REIRDYTLAT VGNRGEVLNR LWQLRPNSLS EAVSSGFRFG QFNIERVLKA       120
     FLPGAIPARF SDLLIPLKVT ATDYYGQSER ICESGDLHKA IAASCALPAI FMPVKIEGRV       180
     MIDGGMYNPI PFDHLRELAD IVIAVDVVGG PDGDGKTIPS RIDSLFGASQ LMMQSIIAMK       240
     MKAGAPDILL RPEVGRFRAL DFLRARDVLA ATASTKEQLK RALSERIDQW QAGR             294
//

If you have problems or comments...

PBIL Back to PBIL home page