(data stored in ACNUC7421 zone)

EMBL: CP001389.PE414

CP001389.PE414       Location/Qualifiers
FT   CDS             472916..474277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04220"
FT                   /product="putative Zn-dependent protease, PmbA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24218"
FT                   /db_xref="GOA:C3MGV3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV3"
FT                   /protein_id="ACP24218.1"
FT                   /translation="MKGLIMSETIDSAILEKRAAELVDRACQAGAEAADAVVVRGRSRS
FT                   VSVRLGKVEATEASESDDFSLRVFVGRRVASVSANPGFDLKVLAERAVAMAKASPEDPY
FT                   ASLADPDRLAKSYPDLDLFDMREVSSEALTEAALAAEAAALSVAGVTNSSGAGASAGMG
FT                   GLVLVTSHGFSGSYLATRFGRSVSAIAGEGTKMERDYDYDSRLYFDDLRSADDIGRVAG
FT                   ERAVARLNPRQVPTAKNVTVVFDPRMARGFVGHLAGAINGASVARKTSFLRDMMGKQIM
FT                   KAGIAVTDDPLIVRGSSSRPFDGEGVTGSKLSMVEDGVLKHWFLSTSAARELGLETNGR
FT                   GVRGGPTVNPASTNLALEPGTLSRDDLIRDVGTGFYVTELIGQGVNMVTGEYSRGASGF
FT                   WIENGELTFPVSEVTIASNLKHMFMALTPADDIDRKFGIAAPTLAVEGMTLAGT"
     MKGLIMSETI DSAILEKRAA ELVDRACQAG AEAADAVVVR GRSRSVSVRL GKVEATEASE        60
     SDDFSLRVFV GRRVASVSAN PGFDLKVLAE RAVAMAKASP EDPYASLADP DRLAKSYPDL       120
     DLFDMREVSS EALTEAALAA EAAALSVAGV TNSSGAGASA GMGGLVLVTS HGFSGSYLAT       180
     RFGRSVSAIA GEGTKMERDY DYDSRLYFDD LRSADDIGRV AGERAVARLN PRQVPTAKNV       240
     TVVFDPRMAR GFVGHLAGAI NGASVARKTS FLRDMMGKQI MKAGIAVTDD PLIVRGSSSR       300
     PFDGEGVTGS KLSMVEDGVL KHWFLSTSAA RELGLETNGR GVRGGPTVNP ASTNLALEPG       360
     TLSRDDLIRD VGTGFYVTEL IGQGVNMVTG EYSRGASGFW IENGELTFPV SEVTIASNLK       420
     HMFMALTPAD DIDRKFGIAA PTLAVEGMTL AGT                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page